Pure Lab.RESEARCH MATERIALS
IN VITRO LABORATORY RESEARCH ONLYQualified research organizations · No human or animal administration

Molecular structure

2D reference
Sequence-derived 2D chemical structure of Alpha-Synuclein, human (1–140), 140 amino-acid residues.
Linear reference chainView full size
Reference sequence140 residues
MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA

Sequence-derived chemical connectivity. Free N terminus and C-terminal acid; no specific 3D fold is implied.

PL-SYN-001 Synuclein peptides & proteins

Alpha-Synuclein, human (1–140)

$39.99

Human alpha-synuclein protein, comprising 140 amino acids for comparative laboratory studies of protein conformation and sequence-dependent molecular association.

In stock

SKU: PL-SYN-001 Category:

Technical identity

Catalog ID
PL-SYN-001
Construct
Human alpha-synuclein residues 1–140
Reference sequence
MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
Calculated reference mass
14460.16 Da — calculated average mass of the unmodified free-acid chain; not a measured result. Tags, termini, modifications, counterions and disulfides change the actual mass.
Reference modifications
Unmodified reference chain

Reference identity: UniProt P37840. Calculated mass describes the reference chain and does not replace a measured lot result.

Documentation

Download molecular reference · CSV

For specification, analytical-record or handling questions, contact our team with the product name or catalog ID.

For qualified organizational in vitro research only. Purchasing access is available to approved research organizations.

Description

Alpha-Synuclein, human (1–140) is a 140-amino-acid protein representing the complete 140-residue human alpha-synuclein sequence. Alpha-synuclein is encoded by the SNCA gene; the reference sequence is recorded as UniProt P37840. Sequence reference: UniProt P37840.

Research context

This chain includes the N-terminal region at parent-sequence residues 1–60; the central non-amyloid-beta component (NAC) region at parent-sequence residues 61–95; the C-terminal region at parent-sequence residues 96–140. The intact sequence brings these regions together in one reference chain for studies of their combined structural and molecular interactions.

Alpha-synuclein is a neuronal protein associated with synaptic vesicle biology. Its molecular association and assembly into amyloid structures are central topics in Parkinson’s disease and synucleinopathy research. Studies distinguish the functions of the N-terminal, NAC, and C-terminal regions and examine how substitutions or truncations change their relationships within the protein. Research reference.

Research applications

  • Comparative characterization of full-length and truncated alpha-synuclein sequences.
  • Mapping regional contributions to protein association and conformational behavior.
  • Biophysical studies of alpha-synuclein-derived chains in defined in vitro systems.

Molecular identity

  • Catalog ID: PL-SYN-001
  • Product type: Protein
  • Reference species: Human (Homo sapiens)
  • Sequence length: 140 amino acids
  • Reference region: Human alpha-synuclein residues 1–140
  • Calculated average molecular mass: 14,460.16 Da for the unmodified free-acid reference chain
  • Sequence modification: Unmodified reference sequence

Reference sequence

MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA

For in vitro laboratory research only. Not for human or animal administration.

Related products