Description
APP770 fragment (700–770) is a 71-amino-acid protein fragment corresponding to residues 700–770 of human amyloid precursor protein isoform APP770. Numbering follows the 770-residue reference sequence in UniProt P05067, allowing this fragment to be aligned directly with other APP-derived materials. Sequence reference: UniProt P05067.
Research context
This fragment covers a C-terminal region of APP770 associated with the transition between the Aβ-containing membrane region and the intracellular tail. Its 700–770 boundaries identify the precise portion retained for comparisons with shorter fragments and other APP C-terminal sequences. It retains the YENPTY motif at APP770 residues 757–762, a region involved in interactions with intracellular adaptor proteins.
APP is a membrane protein whose proteolytic processing produces multiple extracellular and C-terminal fragments, including amyloid-beta peptides. APP research examines how local sequence, cleavage boundaries, and interactions within the C-terminal tail relate to protein processing and signaling. Individual fragments provide defined sequences for studying selected parts of this broader molecular system. Research reference.
Research applications
- Mapping defined APP770 sequence regions and fragment boundaries.
- Comparative characterization of overlapping APP-derived chains.
- Investigating region-specific molecular recognition and protein-interaction sequences.
Molecular identity
- Catalog ID: PL-APP-005
- Product type: Protein
- Reference species: Human (Homo sapiens)
- Sequence length: 71 amino acids
- Reference region: Human APP canonical 770-residue isoform, residues 700–770
- Calculated average molecular mass: 7,902.24 Da for the unmodified free-acid reference chain
- Sequence modification: Unmodified reference sequence
Reference sequence
GAIIGLMVGGVVIATVIVITLVMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQN
For in vitro laboratory research only. Not for human or animal administration.