Pure Lab.RESEARCH MATERIALS
IN VITRO LABORATORY RESEARCH ONLYQualified research organizations · No human or animal administration

Molecular structure

2D reference
Sequence-derived 2D chemical structure of Tau 2N4R fragment (244–372), 129 amino-acid residues.
Linear reference chainView full size
Reference sequence129 residues
QTAPVPMPDLKNVKSKIGSTENLKHQPGGGKVQIINKKLDLSNVQSKCGSKDNIKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIE

Sequence-derived chemical connectivity. Free N terminus and C-terminal acid; no specific 3D fold is implied.

PL-TAU-006 Tau peptides & proteins

Tau 2N4R fragment (244–372)

$54.99

Human tau 2N4R fragment (244–372), comprising 129 amino acids with residue numbering matched to the 441-residue isoform for tau sequence and assembly research.

In stock

SKU: PL-TAU-006 Category:

Technical identity

Catalog ID
PL-TAU-006
Construct
Human tau 2N4R residues 244–372; numbering refers to 441-residue isoform
Reference sequence
QTAPVPMPDLKNVKSKIGSTENLKHQPGGGKVQIINKKLDLSNVQSKCGSKDNIKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIE
Calculated reference mass
13682.73 Da — calculated average mass of the unmodified free-acid chain; not a measured result. Tags, termini, modifications, counterions and disulfides change the actual mass.
Reference modifications
Unmodified reference chain

Reference identity: UniProt P10636-8. Calculated mass describes the reference chain and does not replace a measured lot result.

Documentation

Download molecular reference · CSV

For specification, analytical-record or handling questions, contact our team with the product name or catalog ID.

For qualified organizational in vitro research only. Purchasing access is available to approved research organizations.

Description

Tau 2N4R fragment (244–372) is a 129-amino-acid protein fragment spanning residues 244–372 of human tau 2N4R. All residue numbers refer to the 441-residue 2N4R isoform, UniProt P10636-8. The designation 2N4R identifies two N-terminal inserts and four microtubule-binding repeats in the parent protein. Sequence reference: UniProt P10636-8.

Research context

The fragment covers R1 residues 244–274, R2 residues 275–305, R3 residues 306–336, R4 residues 337–368. Its defined sequence boundaries provide a focused region for studies comparing tau repeat segments and longer chains. The sequence includes PHF6* (VQIINK, residues 275–280) and PHF6 (VQIVYK, residues 306–311), motifs examined in research on tau amyloid assembly.

Tau is a microtubule-associated protein encoded by MAPT. The parent protein contributes to microtubule assembly and stability, while tau self-association and amyloid formation are studied in Alzheimer’s disease and other tauopathies. Sequence-defined proteins and fragments help distinguish the roles of individual regions from the behavior of the complete isoform. Research reference.

Research applications

  • Comparing defined tau 2N4R sequences, fragments, and substitution variants.
  • Mapping regional contributions to tau conformation and molecular association.
  • Sequence-focused investigation of tau assembly in in vitro research systems.

Molecular identity

  • Catalog ID: PL-TAU-006
  • Product type: Protein
  • Reference species: Human (Homo sapiens)
  • Sequence length: 129 amino acids
  • Reference region: Human tau 2N4R residues 244–372; numbering refers to 441-residue isoform
  • Calculated average molecular mass: 13,682.73 Da for the unmodified free-acid reference chain
  • Sequence modification: Unmodified reference sequence

Reference sequence

QTAPVPMPDLKNVKSKIGSTENLKHQPGGGKVQIINKKLDLSNVQSKCGSKDNIKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIE

For in vitro laboratory research only. Not for human or animal administration.

Related products